PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G17440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 457aa    MW: 49800.6 Da    PI: 4.3009
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G17440.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF862.1e-27958150
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                  kri+n++nrqvtfskRrng++KKA+ELSvLCd+++a+++fs++g+l  +s
  OB06G17440.1  9 KRIDNSTNRQVTFSKRRNGLIKKAYELSVLCDIDIALLMFSPSGRLSHFS 58
                  79********************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.38161IPR002100Transcription factor, MADS-box
CDDcd002654.98E-36278No hitNo description
SuperFamilySSF554554.19E-29282IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-25323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MGRVKLQIKR IDNSTNRQVT FSKRRNGLIK KAYELSVLCD IDIALLMFSP SGRLSHFSGR  60
RRIEDVLTRY INLPETDRGG TIQNKEYLIN MLTQLKSESD VAEELTKTSS KAPVDSNIEE  120
LQQEIRTCQH QIQLNEERLR MLEPDPAMFA SMDEVEATEK FIADMLSRVQ ERKRYLLCSH  180
LGSFDVTGST SAMQHVRITQ HGDIAGGGFG SDEVASWVSE GMPEAATSSV ASMFAGPSDS  240
IMSSFRDHQA MYDAMGREAG VETVGPGMEM CHVGQQGQSD DWQQAYTSAE FLSSLIPSTP  300
FPLDEQHGDI AGGGFGSDEV ASWVSEGMPE AATSSVASMF AGPSDSIMSS FRDHQAMYDA  360
MGREAGVETV GPGMEMCHVG QQGQSDDWQQ AYTSAEFLSS LIPSTPFPLD EDVMAPVLAS  420
PPAMIPGVHD DQRPPVEDTE AGCSQAPTDD LAPVNIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-17175174Myocyte-specific enhancer factor 2B
1tqe_R2e-17175174Myocyte-specific enhancer factor 2B
1tqe_Q2e-17175174Myocyte-specific enhancer factor 2B
1tqe_P2e-17175174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015693805.10.0PREDICTED: agamous-like MADS-box protein AGL66 isoform X2
RefseqXP_015693804.10.0PREDICTED: agamous-like MADS-box protein AGL66 isoform X1
TrEMBLJ3MCK00.0J3MCK0_ORYBR; Uncharacterized protein
STRINGOB06G17440.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49533360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.12e-76AGAMOUS-like 66